PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.F02583.1.p
Common NameEUGRSUZ_F02583, LOC104449501
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family MYB
Protein Properties Length: 302aa    MW: 32747 Da    PI: 8.6636
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.F02583.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding574.5e-181461148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      +g+WT+eEd++l+d+++++G g+W++ ++  g+ R++k+c++rw +yl
  Eucgr.F02583.1.p 14 KGAWTKEEDQRLIDYIRLHGEGCWRSLPKSAGLLRCGKSCRLRWINYL 61
                      79******************************99************97 PP

2Myb_DNA-binding59.86e-1967111147
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       rg++T+eEdel+++++ +lG++ W++Ia +++ gRt++++k++w+++
  Eucgr.F02583.1.p  67 RGNFTEEEDELIIKLHSLLGNK-WSLIAGRLP-GRTDNEIKNYWNTH 111
                       89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.607.3E-24564IPR009057Homeodomain-like
PROSITE profilePS5129417.439961IPR017930Myb domain
SuperFamilySSF466898.63E-3013108IPR009057Homeodomain-like
SMARTSM007175.5E-141363IPR001005SANT/Myb domain
PfamPF002492.4E-161461IPR001005SANT/Myb domain
CDDcd001674.22E-121661No hitNo description
PROSITE profilePS5129429.42762116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.4E-2865117IPR009057Homeodomain-like
SMARTSM007174.6E-1866114IPR001005SANT/Myb domain
PfamPF002494.0E-1767111IPR001005SANT/Myb domain
CDDcd001676.40E-1469112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009611Biological Processresponse to wounding
GO:0009651Biological Processresponse to salt stress
GO:0009737Biological Processresponse to abscisic acid
GO:0009751Biological Processresponse to salicylic acid
GO:0090378Biological Processseed trichome elongation
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 302 aa     Download sequence    Send to blast
MGRSPCCEKA HTNKGAWTKE EDQRLIDYIR LHGEGCWRSL PKSAGLLRCG KSCRLRWINY  60
LRPDLKRGNF TEEEDELIIK LHSLLGNKWS LIAGRLPGRT DNEIKNYWNT HIKRKLVSRG  120
IDPQTHRPLN SAVPGVPPAA TSPPSLPVTE ISLISSSLDR RPHGNGYYGR EKLEPKAEPL  180
REDNHCTTSS GTTTDEELKA PRNRQQAQGG SELNLELSIG LAPSCRELNR NASSVTANTA  240
ESKLQEVPYP LLTVPTPAAA AAAAAAAAVC LCCQLGSRSG GMCGNCQSNG GSFGYYAQLG  300
S*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-30141167108B-MYB
1h8a_C5e-301311626128MYB TRANSFORMING PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00053PBMTransfer from AT1G22640Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.F02583.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010061981.10.0PREDICTED: transcription repressor MYB6
SwissprotQ9S9K93e-96MYB3_ARATH; Transcription factor MYB3
TrEMBLA0A059BS020.0A0A059BS02_EUCGR; Uncharacterized protein
STRINGPOPTR_0013s11360.11e-105(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G09460.18e-95myb domain protein 6